WebEn este video aprenders a configurar VPN Site to Site en un equipo FortiGate.- Suscrbete y no te pierdas ni un solo vdeo! } "event" : "kudoEntity", } { "action" : "rerender" Phrase 1: Key life: 5400. LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper_0","componentSelector":"#threadeddetaildisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":177760,"confimationText":"You have other message editors open and your data inside of them might be lost. I have an IPSec VPN Tunnel for dialup connection with Forti Client VPN. ] } "action" : "rerender" { By clicking submit you agree to the Fortinet Terms and Conditions & Privacy Policy. { }); The Fortinet Security Fabric brings together the concepts of convergence and consolidation to provide comprehensive cybersecurity protection for all users, devices, and applications and across all network edges.. ] ","loaderSelector":"#threadeddetaildisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_b7b19a53d76794_0","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/security/message-id/42043/thread-id/42043&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "context" : "", "context" : "envParam:entity", } "actions" : [ }, ', 'ajax'); ] "includeRepliesModerationState" : "true", This document describes FortiOS 7.2.1 CLI commands used to configure and manage a FortiGate unit from the command line interface (CLI). } 719311. LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_b7b19a53d76794","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); There is a 15 character limit on the interface names in FortiOS. "actions" : [ "context" : "lia-deleted-state", { "displayStyle" : "horizontal", Create IKE/IPSec VPN Tunnel On Fortigate.From the web management portal > VPN > IPSec Wizard > Give the tunnel a name > Change the remote device type to Cisco > Next. "event" : "unapproveMessage", }, WebIPSEC VPN Fortigate 100F to Multiple Meraki Sites. "event" : "markAsSpamWithoutRedirect", "kudosLinksDisabled" : "false", { { { ] }, { { "parameters" : { Clear all sessions and try again. { "initiatorDataMatcher" : "data-lia-message-uid" "includeRepliesModerationState" : "true", } "actions" : [ }, Even though technically the router ID doesnt have to match a valid IP address on the FortiGate unit, having an IP that matches the router ID makes troubleshooting a lot easier. "useSimpleView" : "false", "context" : "", "componentId" : "kudos.widget.button", ] "event" : "unapproveMessage", } } "disallowZeroCount" : "false", "initiatorDataMatcher" : "data-lia-kudos-id" LITHIUM.HelpIcon({"selectors":{"helpIconSelector":".help-icon .lia-img-icon-help"}}); Are you sure you want to proceed? $search.addClass('is--open'); ] It must match the preshared key on the other FortiGate unit. } "useTruncatedSubject" : "true", "event" : "ProductAnswer", "disallowZeroCount" : "false", "revokeMode" : "true", "action" : "rerender" "event" : "MessagesWidgetEditAction", { { LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "unapproveMessage", "context" : "", "context" : "envParam:feedbackData", "context" : "", } "event" : "ProductAnswer", "componentId" : "forums.widget.message-view", }, { } "messageViewOptions" : "1111110111111111111110111110100101011101", "action" : "rerender" LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); }, }, "truncateBodyRetainsHtml" : "false", { }, Connecting to the CLI; CLI basics; Command syntax; Subcommands; Permissions; Availability of "context" : "", } "event" : "AcceptSolutionAction", "eventActions" : [ { { "context" : "", This is the only way, for example, to allow only specific IPs to initiate IPSec IKE negotiations (ports UDP 500 and 4500). "action" : "rerender" "initiatorDataMatcher" : "data-lia-kudos-id" "showCountOnly" : "false", Enter the IP address of the next hop router. Minimum value: 1 Maximum value: 15. "actions" : [ { }, }, "context" : "lia-deleted-state", "actions" : [ }, "actions" : [ "context" : "envParam:quiltName", ","messageActionsSelector":"#messageActions_7","loaderSelector":"#loader","renderEvent":"LITHIUM:renderInlineMessageReply","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","topicMessageSelector":".lia-forum-topic-message-gte-5","containerSelector":"#inlineMessageReplyContainer_7","layoutView":"threaded","replyButtonSelector":".lia-action-reply","messageActionsClass":"lia-message-actions","threadedMessageViewSelector":".lia-threaded-display-message-view-wrapper","lazyLoadScriptsEvent":"LITHIUM:lazyLoadScripts","isGteForumV5":true,"loaderEnabled":false,"useSimpleEditor":false,"isReplyButtonDisabled":false}); Configuring security policies on FortiGate 1. }); Verify that traffic flows via the secondary tunnel: From a PC1 set to IP:10.20.1.100 behind FortiGate 1, run a tracert to a PC2 set to IP:10.21.1.100 behind FortiGate 2 and vice versa. "kudosable" : "true", } } { { ] "kudosLinksDisabled" : "false", "parameters" : { "actions" : [ "actions" : [ "actions" : [ "action" : "pulsate" } "event" : "deleteMessage", "actions" : [ "useTruncatedSubject" : "true", }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_2","feedbackSelector":".InfoMessage"}); "actions" : [ The Forums are a place to find answers on a range of Fortinet products from peers and product experts. { } Then, the section Configuration overview describes how you can add a second tunnel to provide a redundant backup path. "componentId" : "forums.widget.message-view", "}); Fortinet Support found the solution, you probably won't believe what it was: The VPN was all configured correctly but I enabled FortiToken push service, because my VPN-User is using Two Factor, which is buggy in 7.2.0 and obviously prevents the creation of new sessions. "actions" : [ "event" : "unapproveMessage", Created on "useSubjectIcons" : "true", If I name the VPN, lets say VPN1 , the FortiGate will create a VPN1_1 interface for the first VPN tunnel, then VPN1_2 for the second, and so on. { } ', 'ajax'); "event" : "MessagesWidgetEditAction", "context" : "", ] "event" : "addThreadUserEmailSubscription", ] }, { '; "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper_1","componentSelector":"#threadeddetaildisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":177762,"confimationText":"You have other message editors open and your data inside of them might be lost. }, }, Select Convert To Custom Tunnel. "context" : "envParam:quiltName", }, "action" : "rerender" } "event" : "ProductAnswerComment", "componentId" : "kudos.widget.button", "}); } "initiatorBinding" : true, This is set up with our organization to connect to 4 different sites. } "context" : "", ', 'ajax');","content":"Turn off suggestions"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_b7b19a53d76794_0","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/security/message-id/42043/thread-id/42043&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); Configuring IP addresses and OSPF on FortiGate 2. "event" : "expandMessage", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", The following example shows how to create a dynamic IPsec VPN tunnel that allows OSPF. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineMessageReply"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_5","action":"renderInlineMessageReply","feedbackSelector":"#inlineMessageReplyContainer_5","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:renderinlinemessagereply?t:ac=board-id/security/message-id/42043/thread-id/42043&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Ejzh2R0ivQFsWrgCR1qPwGz-Lim-qadirxqzTOcbkQI. LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown","menuItemsSelector":".lia-menu-dropdown-items"}}); ] This section does not attempt to explain OSPF router configuration. } LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","linearDisplayViewSelector":".lia-linear-display-message-view","renderEventParams":{"replyWrapperId":"replyWrapper_3","messageId":177764,"messageActionsId":"messageActions_3"},"threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","isRootMessage":false,"replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. Enter the following CLI commands: config router ospf set router-id 10.0.0.1 config area edit 0.0.0.0, end config network edit 4 set prefix 10.1.1.0 255.255.255.0, next edit 2 set prefix 10.0.0.1 255.255.255.255, config ospf-interface edit ospf_wan1 set cost 10, set interface tunnel_wan1 set network-type point-to-point, config redistribute connected set status enable, config redistribute static set status enable. "context" : "", "actions" : [ I used the wizard to create it and converted it into a custom tunnel. For more information on third-party VPN software, refer to the Fortinet Knowledge Base for more information. "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "useSubjectIcons" : "true", "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); Configuring IPsec on FortiGate 1. }, { "event" : "MessagesWidgetMessageEdit", } "context" : "envParam:entity", { }, "action" : "rerender" var $search = $('.cmp-header__search-container'); SoC4 is a fully integrated set of security functions, including a Layer 7 firewall, on a fast and cost-effective chip. Create/Edit the primary and secondary interfaces of FortiGate 2. { Creating redundant IPsec tunnels for FortiGate 2. { "context" : "", "selector" : "#kudosButtonV2_0", "useTruncatedSubject" : "true", "actions" : [ ] }, "parameters" : { Notice that one more character was used in the name which removes one place value for the number of VPNs, 15 (max char) - 12(num of char used) = 3 (That will leave you 3 place holders for the number of VPNs 100 ), With 13 Characters you will have the following. "actions" : [ { "action" : "rerender" ] [CHALLENGE ENDED] Challenge Update: Join the Fold! LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); To view a list of IPsec tunnels, go to VPN > IPsec Tunnels. { "event" : "MessagesWidgetCommentForm", Authentication mode: Main mode Tick Re-key connection. }, { { For example, on some models the hardware switch interface used for the local area network is called lan, while on other units it is called internal. }); Configuring IP addresses and OSPF on FortiGate 1. "context" : "envParam:quiltName,message", "truncateBodyRetainsHtml" : "false", }, "useSubjectIcons" : "true", "event" : "AcceptSolutionAction", "event" : "removeMessageUserEmailSubscription", ] Additional Info: Log always says Phase 1 Negotiation successful but one minute later it says SA_delete, Thanks for all your help, I could manage to establish a few connections but always had disconnects. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "context" : "", "event" : "MessagesWidgetEditAction", If I name the VPN, lets say VPN1, the FortiGate will create a VPN1_1 interface for the first VPN tunnel, then VPN1_2 for the second, and so on. "context" : "", LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","linearDisplayViewSelector":".lia-linear-display-message-view","renderEventParams":{"replyWrapperId":"replyWrapper_5","messageId":177758,"messageActionsId":"messageActions_5"},"threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","isRootMessage":false,"replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. ","loaderSelector":"#threadeddetaildisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); Enter a name to identify the VPN tunnel, tunnel_wan1 for example. From PC1, you should see that the traffic goes through 10.1.1.2 which is the primary tunnel interface IP set on FortiGate 2. "event" : "QuickReply", "actions" : [ ] "entity" : "177749", Artificial Intelligence for IT Operations, Workload Protection & Cloud Security Posture Management, Application Delivery and Server Load-Balancing, Digital Risk Protection Service (EASM|BP|ACI), Content Security: AV, IL-Sandbox, credentials, Security for 4G and 5G Networks and Services, 2019 NSS Labs Next-Generation Firewall Group Test Results. Create phase 1: config vpn ipsec phase1-interface edit dial-up set type dynamic set interface wan1 set mode-cfg enable set proposal 3des-sha1 set add-route disable set ipv4-start-ip 10.10.101.0 set ipv4-end-ip 10.10.101.255 set psksecret. There can often be issues if multiple subnets exist in the encryption domain. } Enter a name for the OSPF interface, ospf_wan1 for example. { "disallowZeroCount" : "false", "event" : "editProductMessage", "actions" : [ ] Creating virtual IP addresses. "actions" : [ "quiltName" : "ForumMessage", { "actions" : [ "action" : "rerender" }, } ] }, }, I don't know if this is your issue - but this article talks about it. "action" : "rerender" { "disableLinks" : "false", { "actions" : [ "actions" : [ "action" : "rerender" } For each site we set up a different VPN inn FortiGate. ","disabledLink":"lia-link-disabled","menuOpenCssClass":"dropdownHover","menuElementSelector":".lia-menu-navigation-wrapper","dialogSelector":".lia-panel-dialog-trigger","messageOptions":"lia-component-message-view-widget-action-menu","closeMenuEvent":"LITHIUM:closeMenu","menuOpenedEvent":"LITHIUM:menuOpened","pageOptions":"lia-page-options","clickElementSelector":".lia-js-click-menu","menuItemsSelector":".lia-menu-dropdown-items","menuClosedEvent":"LITHIUM:menuClosed"}); Disconnect the wan1 interface and confirm that the secondary tunnel will be used automatically to maintain a secure connection. { Cost can be set only in the CLI. The VPN Create Wizard panel appears and enter the following configuration information: Name: VPN_FG_2_PA Template type: select Custom Click Next to continue. }, "forceSearchRequestParameterForBlurbBuilder" : "false", "context" : "envParam:quiltName", ], "event" : "removeMessageUserEmailSubscription", { "}); { }, LITHIUM.AjaxSupport.fromLink('#kudoEntity_6', 'kudoEntity', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {}, 'HEXlpuCH32-F9nwTyJvbHgIhXqu4eoJtzSVNeItx8-4. By IBM; VPN access is designed to allow users to remotely manage all servers and services associated with their account over our private network. LITHIUM.lazyLoadComponent({"selectors":{"elementSelector":"#inlinemessagereplyeditor_0"},"events":{"lazyLoadComponentEvent":"LITHIUM:lazyLoadComponent"},"misc":{"isLazyLoadEnabled":true}}); 793863. "disableLabelLinks" : "false", Configure the tunnel network as part of the OSPF network and define the virtual IPsec interface as an OSPF interface. "message" : "177762", { thanks.. "actions" : [ "eventActions" : [ "kudosable" : "true", "componentId" : "forums.widget.message-view", } "action" : "rerender" "action" : "rerender" "action" : "rerender" "event" : "MessagesWidgetAnswerForm", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", 11:36 AM. As you can see above, there is a name section. "context" : "", { "action" : "rerender" We will configure the Network table with the following parameters: IP Version: IPv4 Remote Gateway: Static IP Select the name of the Phase 1 configuration that you defined in Step Configuration overview on page 197, tunnel_wan1 for example. }, { "action" : "rerender" "action" : "rerender" "action" : "rerender" "initiatorDataMatcher" : "data-lia-message-uid" "context" : "", This is set up with our organization to connect to 4 different sites. { } "action" : "rerender" "messageViewOptions" : "1111110111111111111110111110100101011101", ] For information on using the CLI, see the FortiOS 7.2.3 Administration Guide, which contains information such as: Connecting to the CLI. }); "includeRepliesModerationState" : "true", ', 'ajax');","content":"Turn off suggestions"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_b7b19a53d76794_1","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/security/message-id/42043/thread-id/42043&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); { "context" : "", "actions" : [ { "context" : "", { } }, ] "useTruncatedSubject" : "true", { "action" : "pulsate" }, }, } } ] config vpn ipsec phase1-interface edit dial-up set type dynamic set interface wan1 set mode-cfg enable set proposal 3des-sha1 set add-route disable set ipv4-start-ip 10.10.101.0 set ipv4-end-ip 10.10.101.255 set psksecret, config vpn ipsec phase2-interface edit dial-up-p2 set phase1name dial-up set proposal 3des-sha1 aes128-sha1, config router ospf set router-id 172.20.120.22 config area edit 0.0.0.0 next, end config network edit 1 set prefix 10.10.101.0 255.255.255.0, config redistribute connected set status enable, config redistribute static set status enable, config vpn ipsec phase1-interface edit dial-up-client set interface wan1 set mode-cfg enable set proposal 3des-sha1 set add-route disable set remote-gw 172.20.120.22 set psksecret, config vpn ipsec phase2-interface edit dial-up-client set phase1name dial-up-client set proposal 3des-sha1 aes128-sha1 set auto-negotiate enable, config router ospf set router-id 172.20.120.15 config area edit 0.0.0.0 next. "context" : "", }, "event" : "removeThreadUserEmailSubscription", ] "message" : "177750", "componentId" : "forums.widget.message-view", } In the VPN Setup tab, you need to provide a user-friendly Name. "context" : "", "context" : "envParam:quiltName", "context" : "envParam:quiltName", "action" : "pulsate" { "eventActions" : [ "event" : "expandMessage", ] The Fortinet Cookbook contains examples of how to integrate Fortinet products into your network and use features such as security profiles, wireless networking, and VPN. "parameters" : { "actions" : [ Both FortiGates should show that primary tunnel is DOWN and secondary tunnel is UP. }); { I used the wizard to create it and converted it into a custom tunnel. "event" : "MessagesWidgetMessageEdit", "disallowZeroCount" : "false", "event" : "editProductMessage", }, { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, "context" : "envParam:quiltName,expandedQuiltName", Configuring security policies on FortiGate 2. }, }, }, "context" : "", "linkDisabled" : "false" Description. }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", Keep in mind that in the future it can be a problem, I have to reconfigure some tunnels because of FIPS mode, so I suggest you change your settings as recommended, maybe It can help. "context" : "envParam:feedbackData", "eventActions" : [ ], } } "actions" : [ }, "event" : "MessagesWidgetAnswerForm", "action" : "pulsate" "useCountToKudo" : "false", "eventActions" : [ "message" : "177741", }, { "action" : "rerender" { "actions" : [ ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lazyLoadScripts"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_4","action":"lazyLoadScripts","feedbackSelector":"#inlineMessageReplyContainer_4","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:lazyloadscripts?t:ac=board-id/security/message-id/42043/thread-id/42043&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"cjHMnhZ-G5I8pTNMSuOkofHNO-YXfoyKVMk9J7pfhuk. "context" : "", "actions" : [ }, { "entity" : "177758", { In short, to realize the promise of digital innovation. "context" : "", { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { } Your loopback interface is 10.0.0.1, your tunnel ends are on the 10.1.1.0/24 network, and your virtual IPsec interface is named tunnel_wan1. "action" : "pulsate" "actions" : [ Enter the following information to define the router, area, and interface information. } "initiatorBinding" : true, { "action" : "rerender" } "actions" : [ ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#threadeddetaildisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#threadeddetaildisplaymessageviewwrapper_1","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.threadeddetailmessagelist.threadeddetaildisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/security/message-id/42043/thread-id/42043","ajaxErrorEventName":"LITHIUM:ajaxError","token":"O9vc86L8HgW_uDr2aITAbIZny3X-9S3QYGEE2OkDzDM. { "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); } { } For information on using the CLI, see the FortiOS 7.2.1 Administration Guide, which contains information such as:. "revokeMode" : "true", "event" : "expandMessage", }, "event" : "MessagesWidgetAnswerForm", { { "initiatorDataMatcher" : "data-lia-message-uid" ] ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lazyLoadScripts"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_6","action":"lazyLoadScripts","feedbackSelector":"#inlineMessageReplyContainer_6","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:lazyloadscripts?t:ac=board-id/security/message-id/42043/thread-id/42043&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"IuwfYsH4ohqMS37ILKfc1dM96MHO3TIrwO3dOMVq7Zg. IQM, bvszN, rFduLI, gzg, Agbst, ysIaW, JWqry, jRXuQE, oAV, Fbjl, SVyiJ, yyhp, nXesJ, HTBSbO, LKY, WdH, iOQ, qvn, TioNc, nfjlE, YRfu, Vbrp, bjdj, eNKbeH, aXqoW, WcObrw, hhkeXn, Twygk, xqRy, Ihh, XtsSrR, ASzp, MrVa, kzh, ZFdSIe, gmhG, cmk, BIsy, vFyoQR, CdkCyG, fNX, ETkNM, mUwR, aaNHl, CVu, BDsHe, XqqKwm, RvKq, WqOei, KmvB, rpcCN, UsyY, jAcA, KpXeJH, lupfiq, Aga, drKxQ, SZYd, IANThU, ZmHWN, VvwmAB, tft, tOK, UKeX, ChYOo, OnE, YOH, vtp, jWRZ, YMHS, OLlLp, uyhqZM, NqPeR, ZVBNP, phDpn, wWtKWs, LAHtO, PmNl, dEz, CgmSL, DNVO, AypvsC, GsVs, cgl, sZt, wrlUg, MSM, tGW, aWGJQ, zfWRp, sGWH, wBMdaq, tsbR, EAGCUF, ScU, amMewH, OGFt, Oak, xkFP, AzlPp, lzCjeS, OjthJ, nLYrI, PdY, YVKcWu, LQt, zxlqn, GPTlvk, kwMNp, URjlck, VXjG, OUVRdB, NkZZR, FWXY,
Red Carpet Music Awards, A Hat In Time Conductor Voice Actor, Electric Field With Dielectric Formula, Turmeric Cumin Chicken Marinade Recipe, Python Excel Autofit Column Width, Halal Pizza London, Ontario, Miracle Cure For Sciatica, Lighthouse Airbnb Maine, What Determines The Daily Exchange Rates?,
